Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for GENE 433 11. GENE 433 3 pts. 8,995
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 8,967
  3. Avatar for Team China 13. Team China 1 pt. 8,961
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,515
  5. Avatar for Ogre's lab 15. Ogre's lab 1 pt. 8,234
  6. Avatar for Beta Folders 16. Beta Folders 1 pt. 8,133
  7. Avatar for Window Group 17. Window Group 1 pt. 6,474
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,351
  9. Avatar for Haykapnayan 19. Haykapnayan 1 pt. 5,351
  10. Avatar for test_group1 20. test_group1 1 pt. 5,351
  1. Avatar for zbp 101. zbp Lv 1 1 pt. 7,556
  2. Avatar for apetrides 102. apetrides Lv 1 1 pt. 7,489
  3. Avatar for lezhe 103. lezhe Lv 1 1 pt. 7,489
  4. Avatar for furi0us 104. furi0us Lv 1 1 pt. 7,446
  5. Avatar for LeoClaxton 105. LeoClaxton Lv 1 1 pt. 7,353
  6. Avatar for kungenoch 106. kungenoch Lv 1 1 pt. 7,344
  7. Avatar for nasaspacex 107. nasaspacex Lv 1 1 pt. 7,256
  8. Avatar for ChiragMaan 108. ChiragMaan Lv 1 1 pt. 7,197
  9. Avatar for jflat06 109. jflat06 Lv 1 1 pt. 6,474
  10. Avatar for Nellymmmm 110. Nellymmmm Lv 1 1 pt. 5,841

Comments