Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for GENE 433 11. GENE 433 3 pts. 8,995
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 8,967
  3. Avatar for Team China 13. Team China 1 pt. 8,961
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,515
  5. Avatar for Ogre's lab 15. Ogre's lab 1 pt. 8,234
  6. Avatar for Beta Folders 16. Beta Folders 1 pt. 8,133
  7. Avatar for Window Group 17. Window Group 1 pt. 6,474
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,351
  9. Avatar for Haykapnayan 19. Haykapnayan 1 pt. 5,351
  10. Avatar for test_group1 20. test_group1 1 pt. 5,351
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 66 pts. 9,639
  2. Avatar for AlphaFold2 12. AlphaFold2 Lv 1 64 pts. 9,637
  3. Avatar for gmn 13. gmn Lv 1 61 pts. 9,630
  4. Avatar for MicElephant 14. MicElephant Lv 1 58 pts. 9,627
  5. Avatar for Sandrix72 15. Sandrix72 Lv 1 56 pts. 9,626
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 53 pts. 9,623
  7. Avatar for borattt 17. borattt Lv 1 51 pts. 9,608
  8. Avatar for RockOn 18. RockOn Lv 1 49 pts. 9,596
  9. Avatar for robgee 19. robgee Lv 1 46 pts. 9,579
  10. Avatar for jobo0502 20. jobo0502 Lv 1 44 pts. 9,578

Comments