Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for GENE 433 11. GENE 433 3 pts. 8,995
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 8,967
  3. Avatar for Team China 13. Team China 1 pt. 8,961
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,515
  5. Avatar for Ogre's lab 15. Ogre's lab 1 pt. 8,234
  6. Avatar for Beta Folders 16. Beta Folders 1 pt. 8,133
  7. Avatar for Window Group 17. Window Group 1 pt. 6,474
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,351
  9. Avatar for Haykapnayan 19. Haykapnayan 1 pt. 5,351
  10. Avatar for test_group1 20. test_group1 1 pt. 5,351
  1. Avatar for Vinara 31. Vinara Lv 1 26 pts. 9,451
  2. Avatar for BootsMcGraw 32. BootsMcGraw Lv 1 25 pts. 9,442
  3. Avatar for alcor29 33. alcor29 Lv 1 23 pts. 9,440
  4. Avatar for fiendish_ghoul 34. fiendish_ghoul Lv 1 22 pts. 9,434
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 21 pts. 9,401
  6. Avatar for fpc 36. fpc Lv 1 20 pts. 9,396
  7. Avatar for Blipperman 37. Blipperman Lv 1 19 pts. 9,394
  8. Avatar for carxo 38. carxo Lv 1 18 pts. 9,367
  9. Avatar for manu8170 39. manu8170 Lv 1 17 pts. 9,367
  10. Avatar for Oransche 40. Oransche Lv 1 16 pts. 9,363

Comments