Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for GENE 433 11. GENE 433 3 pts. 8,995
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 8,967
  3. Avatar for Team China 13. Team China 1 pt. 8,961
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,515
  5. Avatar for Ogre's lab 15. Ogre's lab 1 pt. 8,234
  6. Avatar for Beta Folders 16. Beta Folders 1 pt. 8,133
  7. Avatar for Window Group 17. Window Group 1 pt. 6,474
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,351
  9. Avatar for Haykapnayan 19. Haykapnayan 1 pt. 5,351
  10. Avatar for test_group1 20. test_group1 1 pt. 5,351

  1. Avatar for Merf 51. Merf Lv 1 8 pts. 9,209
  2. Avatar for Deleted player 52. Deleted player 8 pts. 9,204
  3. Avatar for stomjoh 53. stomjoh Lv 1 7 pts. 9,176
  4. Avatar for antibot215 54. antibot215 Lv 1 7 pts. 9,170
  5. Avatar for Trajan464 55. Trajan464 Lv 1 6 pts. 9,137
  6. Avatar for equilibria 56. equilibria Lv 1 6 pts. 9,119
  7. Avatar for bamh 57. bamh Lv 1 6 pts. 9,106
  8. Avatar for DScott 58. DScott Lv 1 5 pts. 9,069
  9. Avatar for jamiexq 60. jamiexq Lv 1 5 pts. 9,062

Comments