2131: Revisiting Puzzle 135: E. coli
Closed since almost 4 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- April 07, 2022
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW