Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since almost 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,864
  2. Avatar for Go Science 2. Go Science 77 pts. 9,719
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 9,686
  4. Avatar for Contenders 4. Contenders 43 pts. 9,679
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,639
  6. Avatar for AlphaFold 6. AlphaFold 22 pts. 9,637
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 9,623
  8. Avatar for BOINC@Poland 8. BOINC@Poland 11 pts. 9,241
  9. Avatar for BioCentric 9. BioCentric 7 pts. 9,036
  10. Avatar for Australia 10. Australia 5 pts. 9,033

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,864
  2. Avatar for guineapig 2. guineapig Lv 1 97 pts. 9,834
  3. Avatar for g_b 3. g_b Lv 1 93 pts. 9,739
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 89 pts. 9,719
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 85 pts. 9,716
  6. Avatar for Galaxie 6. Galaxie Lv 1 82 pts. 9,709
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 79 pts. 9,708
  8. Avatar for frood66 8. frood66 Lv 1 75 pts. 9,684
  9. Avatar for NeLikomSheet 9. NeLikomSheet Lv 1 72 pts. 9,672
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 69 pts. 9,666

Comments