Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,063
  2. Avatar for jobo0502 2. jobo0502 Lv 1 96 pts. 9,991
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 91 pts. 9,950
  4. Avatar for robgee 4. robgee Lv 1 87 pts. 9,937
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 83 pts. 9,921
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 79 pts. 9,899
  7. Avatar for Blipperman 7. Blipperman Lv 1 75 pts. 9,894
  8. Avatar for guineapig 8. guineapig Lv 1 72 pts. 9,875
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 68 pts. 9,875
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 65 pts. 9,871

Comments