Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,078
  2. Avatar for LociOiling 2. LociOiling Lv 1 70 pts. 10,060
  3. Avatar for gmn 3. gmn Lv 1 47 pts. 10,059
  4. Avatar for phi16 4. phi16 Lv 1 30 pts. 10,005
  5. Avatar for alcor29 5. alcor29 Lv 1 19 pts. 9,960
  6. Avatar for robgee 6. robgee Lv 1 11 pts. 9,956
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 7 pts. 9,950
  8. Avatar for guineapig 8. guineapig Lv 1 4 pts. 9,876
  9. Avatar for MicElephant 9. MicElephant Lv 1 2 pts. 9,874
  10. Avatar for Beany 10. Beany Lv 1 1 pt. 9,847

Comments