Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 14,200
  2. Avatar for Window Group 12. Window Group 1 pt. 0
  3. Avatar for TISKEMI2 13. TISKEMI2 1 pt. 0
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  1. Avatar for cfabs 91. cfabs Lv 1 1 pt. 0
  2. Avatar for Agnieszka158 92. Agnieszka158 Lv 1 1 pt. 0
  3. Avatar for shamail 93. shamail Lv 1 1 pt. 0
  4. Avatar for borattt 94. borattt Lv 1 1 pt. 0
  5. Avatar for Sciren 95. Sciren Lv 1 1 pt. 0
  6. Avatar for spvincent 96. spvincent Lv 1 1 pt. 0

Comments