Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 14,200
  2. Avatar for Window Group 12. Window Group 1 pt. 0
  3. Avatar for TISKEMI2 13. TISKEMI2 1 pt. 0
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 58 pts. 16,538
  2. Avatar for ucad 12. ucad Lv 1 55 pts. 16,516
  3. Avatar for gmn 13. gmn Lv 1 51 pts. 16,511
  4. Avatar for guineapig 14. guineapig Lv 1 48 pts. 16,497
  5. Avatar for MrZanav 15. MrZanav Lv 1 46 pts. 16,494
  6. Avatar for NPrincipi 16. NPrincipi Lv 1 43 pts. 16,469
  7. Avatar for zippyc137 17. zippyc137 Lv 1 40 pts. 16,465
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 38 pts. 16,462
  9. Avatar for g_b 19. g_b Lv 1 35 pts. 16,447
  10. Avatar for Lotus23 20. Lotus23 Lv 1 33 pts. 16,443

Comments