Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups


  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 14,200
  2. Avatar for Window Group 12. Window Group 1 pt. 0
  3. Avatar for TISKEMI2 13. TISKEMI2 1 pt. 0
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0

  1. Avatar for robgee 21. robgee Lv 1 31 pts. 16,431
  2. Avatar for akaaka 22. akaaka Lv 1 29 pts. 16,411
  3. Avatar for jobo0502 23. jobo0502 Lv 1 27 pts. 16,400
  4. Avatar for Cyberkashi 24. Cyberkashi Lv 1 26 pts. 16,367
  5. Avatar for RockOn 25. RockOn Lv 1 24 pts. 16,319
  6. Avatar for ichwilldiesennamen 26. ichwilldiesennamen Lv 1 22 pts. 16,314
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 21 pts. 16,258
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 19 pts. 16,257
  9. Avatar for bamh 29. bamh Lv 1 18 pts. 16,244
  10. Avatar for Skippysk8s 30. Skippysk8s Lv 1 17 pts. 16,239

Comments