Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 14,200
  2. Avatar for Window Group 12. Window Group 1 pt. 0
  3. Avatar for TISKEMI2 13. TISKEMI2 1 pt. 0
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  1. Avatar for Oransche 61. Oransche Lv 1 1 pt. 14,482
  2. Avatar for blazegeek 62. blazegeek Lv 1 1 pt. 14,478
  3. Avatar for TheGUmmer 63. TheGUmmer Lv 1 1 pt. 14,390
  4. Avatar for Dr.Sillem 64. Dr.Sillem Lv 1 1 pt. 14,381
  5. Avatar for abiogenesis 65. abiogenesis Lv 1 1 pt. 14,314
  6. Avatar for tracybutt 66. tracybutt Lv 1 1 pt. 14,200
  7. Avatar for DScott 67. DScott Lv 1 1 pt. 14,181
  8. Avatar for Bautho 68. Bautho Lv 1 1 pt. 14,173
  9. Avatar for antibot215 69. antibot215 Lv 1 1 pt. 14,063
  10. Avatar for fiendish_ghoul 70. fiendish_ghoul Lv 1 1 pt. 13,937

Comments