Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 16,734
  2. Avatar for Go Science 2. Go Science 68 pts. 16,695
  3. Avatar for Contenders 3. Contenders 44 pts. 16,651
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 16,572
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 16,462
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 16,239
  7. Avatar for Australia 7. Australia 5 pts. 15,674
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 15,230
  9. Avatar for VeFold 9. VeFold 1 pt. 15,177
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 14,390
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 16,734
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 73 pts. 16,687
  3. Avatar for LociOiling 3. LociOiling Lv 1 52 pts. 16,685
  4. Avatar for alcor29 4. alcor29 Lv 1 36 pts. 16,672
  5. Avatar for guineapig 5. guineapig Lv 1 24 pts. 16,651
  6. Avatar for MicElephant 6. MicElephant Lv 1 16 pts. 16,647
  7. Avatar for gmn 7. gmn Lv 1 10 pts. 16,644
  8. Avatar for Anfinsen_slept_here 8. Anfinsen_slept_here Lv 1 6 pts. 16,625
  9. Avatar for Cyberkashi 9. Cyberkashi Lv 1 4 pts. 16,612
  10. Avatar for maithra 10. maithra Lv 1 2 pts. 16,580

Comments