Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 16,734
  2. Avatar for Go Science 2. Go Science 68 pts. 16,695
  3. Avatar for Contenders 3. Contenders 44 pts. 16,651
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 16,572
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 16,462
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 16,239
  7. Avatar for Australia 7. Australia 5 pts. 15,674
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 15,230
  9. Avatar for VeFold 9. VeFold 1 pt. 15,177
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 14,390
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 16,695
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 16,681
  3. Avatar for Galaxie 3. Galaxie Lv 1 90 pts. 16,680
  4. Avatar for LociOiling 4. LociOiling Lv 1 86 pts. 16,666
  5. Avatar for MicElephant 5. MicElephant Lv 1 81 pts. 16,641
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 77 pts. 16,626
  7. Avatar for jeff101 7. jeff101 Lv 1 73 pts. 16,625
  8. Avatar for grogar7 8. grogar7 Lv 1 69 pts. 16,588
  9. Avatar for jausmh 9. jausmh Lv 1 65 pts. 16,572
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 61 pts. 16,545

Comments