2137: Electron Density Reconstruction 7
Closed since about 4 years ago
Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron DensitySummary
- Created
- April 21, 2022
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.
Sequence:
MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Top groups
-
100 pts. 16,734
-
-
-
-
-
-
-
-
-