Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Team China 11. Team China 2 pts. 10,145
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,034
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,996
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 9,993
  5. Avatar for CHE222 1 15. CHE222 1 1 pt. 9,349
  6. Avatar for test 2 16. test 2 1 pt. 8,533
  7. Avatar for Window Group 17. Window Group 1 pt. 8,456
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,438

  1. Avatar for Pazithi 11. Pazithi Lv 1 62 pts. 11,569
  2. Avatar for BassPlayer 12. BassPlayer Lv 1 59 pts. 11,565
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 56 pts. 11,545
  4. Avatar for robgee 14. robgee Lv 1 53 pts. 11,525
  5. Avatar for fpc 15. fpc Lv 1 50 pts. 11,499
  6. Avatar for gmn 16. gmn Lv 1 48 pts. 11,491
  7. Avatar for Sandrix72 17. Sandrix72 Lv 1 45 pts. 11,486
  8. Avatar for Punzi Baker 3 18. Punzi Baker 3 Lv 1 43 pts. 11,483
  9. Avatar for akaaka 19. akaaka Lv 1 41 pts. 11,479
  10. Avatar for ichwilldiesennamen 20. ichwilldiesennamen Lv 1 39 pts. 11,464

Comments