Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 10,145
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,034
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,996
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 9,993
  5. Avatar for CHE222 1 15. CHE222 1 1 pt. 9,349
  6. Avatar for test 2 16. test 2 1 pt. 8,533
  7. Avatar for Window Group 17. Window Group 1 pt. 8,456
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,438
  1. Avatar for phi16 21. phi16 Lv 1 36 pts. 11,450
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 34 pts. 11,410
  3. Avatar for guineapig 23. guineapig Lv 1 33 pts. 11,408
  4. Avatar for g_b 24. g_b Lv 1 31 pts. 11,404
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 29 pts. 11,396
  6. Avatar for Lotus23 26. Lotus23 Lv 1 27 pts. 11,368
  7. Avatar for Phyx 27. Phyx Lv 1 26 pts. 11,368
  8. Avatar for Crossed Sticks 28. Crossed Sticks Lv 1 24 pts. 11,322
  9. Avatar for maithra 29. maithra Lv 1 23 pts. 11,312
  10. Avatar for drumpeter18yrs9yrs 30. drumpeter18yrs9yrs Lv 1 21 pts. 11,286

Comments