Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 10,145
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,034
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,996
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 9,993
  5. Avatar for CHE222 1 15. CHE222 1 1 pt. 9,349
  6. Avatar for test 2 16. test 2 1 pt. 8,533
  7. Avatar for Window Group 17. Window Group 1 pt. 8,456
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,438
  1. Avatar for PeterDav 31. PeterDav Lv 1 20 pts. 11,282
  2. Avatar for BarrySampson 32. BarrySampson Lv 1 19 pts. 11,268
  3. Avatar for Blipperman 33. Blipperman Lv 1 18 pts. 11,241
  4. Avatar for Visok 34. Visok Lv 1 17 pts. 11,234
  5. Avatar for NPrincipi 35. NPrincipi Lv 1 16 pts. 11,225
  6. Avatar for infjamc 36. infjamc Lv 1 15 pts. 11,215
  7. Avatar for Alistair69 37. Alistair69 Lv 1 14 pts. 11,210
  8. Avatar for BootsMcGraw 38. BootsMcGraw Lv 1 13 pts. 11,197
  9. Avatar for Trajan464 39. Trajan464 Lv 1 12 pts. 11,187
  10. Avatar for stomjoh 40. stomjoh Lv 1 11 pts. 11,181

Comments