Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 10,145
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,034
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,996
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 9,993
  5. Avatar for CHE222 1 15. CHE222 1 1 pt. 9,349
  6. Avatar for test 2 16. test 2 1 pt. 8,533
  7. Avatar for Window Group 17. Window Group 1 pt. 8,456
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,438
  1. Avatar for extremely player 61. extremely player Lv 1 2 pts. 10,724
  2. Avatar for jakeanderson 62. jakeanderson Lv 1 2 pts. 10,692
  3. Avatar for carxo 63. carxo Lv 1 2 pts. 10,678
  4. Avatar for borattt 64. borattt Lv 1 2 pts. 10,658
  5. Avatar for Simek 65. Simek Lv 1 2 pts. 10,619
  6. Avatar for AlkiP0Ps 66. AlkiP0Ps Lv 1 2 pts. 10,602
  7. Avatar for InariInari2020 67. InariInari2020 Lv 1 1 pt. 10,480
  8. Avatar for pfirth 68. pfirth Lv 1 1 pt. 10,391
  9. Avatar for Larini 69. Larini Lv 1 1 pt. 10,385
  10. Avatar for rinze 70. rinze Lv 1 1 pt. 10,369

Comments