Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,903
  2. Avatar for Go Science 2. Go Science 74 pts. 11,768
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 11,714
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 11,639
  5. Avatar for Contenders 5. Contenders 27 pts. 11,629
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,627
  7. Avatar for GENE 433 7. GENE 433 12 pts. 10,965
  8. Avatar for Australia 8. Australia 8 pts. 10,757
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,619
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,265

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,903
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 96 pts. 11,768
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 92 pts. 11,714
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 87 pts. 11,710
  5. Avatar for Skippysk8s 5. Skippysk8s Lv 1 83 pts. 11,639
  6. Avatar for MicElephant 6. MicElephant Lv 1 79 pts. 11,629
  7. Avatar for jausmh 7. jausmh Lv 1 76 pts. 11,625
  8. Avatar for jobo0502 8. jobo0502 Lv 1 72 pts. 11,621
  9. Avatar for Idiotboy 9. Idiotboy Lv 1 69 pts. 11,616
  10. Avatar for Galaxie 10. Galaxie Lv 1 65 pts. 11,599

Comments