Placeholder image of a protein
Icon representing a puzzle

2161: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
June 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 10,697
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 10,558
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 10,310
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,273
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 9,034
  6. Avatar for fechan's test group 16. fechan's test group 1 pt. 8,820

  1. Avatar for WBarme1234 31. WBarme1234 Lv 1 20 pts. 11,147
  2. Avatar for bamh 32. bamh Lv 1 19 pts. 11,147
  3. Avatar for maithra 33. maithra Lv 1 18 pts. 11,119
  4. Avatar for ucad 34. ucad Lv 1 17 pts. 11,109
  5. Avatar for NPrincipi 35. NPrincipi Lv 1 16 pts. 11,105
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 15 pts. 11,083
  7. Avatar for Zhang Ruichong 37. Zhang Ruichong Lv 1 14 pts. 11,069
  8. Avatar for robgee 38. robgee Lv 1 13 pts. 11,062
  9. Avatar for fiendish_ghoul 39. fiendish_ghoul Lv 1 12 pts. 11,056
  10. Avatar for equilibria 40. equilibria Lv 1 11 pts. 11,030

Comments