Placeholder image of a protein
Icon representing a puzzle

2161: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
June 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 10,697
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 10,558
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 10,310
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,273
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 9,034
  6. Avatar for fechan's test group 16. fechan's test group 1 pt. 8,820

  1. Avatar for DScott 81. DScott Lv 1 1 pt. 10,193
  2. Avatar for Moimeme163 82. Moimeme163 Lv 1 1 pt. 10,183
  3. Avatar for fracata 83. fracata Lv 1 1 pt. 10,170
  4. Avatar for borattt 84. borattt Lv 1 1 pt. 10,169
  5. Avatar for Abbastanji 85. Abbastanji Lv 1 1 pt. 10,168
  6. Avatar for sole987654321 86. sole987654321 Lv 1 1 pt. 10,165
  7. Avatar for pruneau_44 87. pruneau_44 Lv 1 1 pt. 10,161
  8. Avatar for Mohoernchen 88. Mohoernchen Lv 1 1 pt. 10,157
  9. Avatar for gask09 89. gask09 Lv 1 1 pt. 10,154
  10. Avatar for Camma 90. Camma Lv 1 1 pt. 10,113

Comments