Placeholder image of a protein
Icon representing a puzzle

2161: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
June 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,625
  2. Avatar for Go Science 2. Go Science 71 pts. 11,566
  3. Avatar for Contenders 3. Contenders 49 pts. 11,463
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,418
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,392
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,377
  7. Avatar for METU-BIN 7. METU-BIN 8 pts. 11,166
  8. Avatar for Team China 8. Team China 5 pts. 11,069
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,830
  10. Avatar for Australia 10. Australia 2 pts. 10,806

  1. Avatar for HCresF 101. HCresF Lv 1 1 pt. 9,014
  2. Avatar for Nougat 102. Nougat Lv 1 1 pt. 8,878
  3. Avatar for Cojo_Samu 103. Cojo_Samu Lv 1 1 pt. 8,841
  4. Avatar for SaraVenegoni 104. SaraVenegoni Lv 1 1 pt. 8,820
  5. Avatar for leonardo_sofia 105. leonardo_sofia Lv 1 1 pt. 8,820
  6. Avatar for 201611790 106. 201611790 Lv 1 1 pt. 8,820
  7. Avatar for apetrides 107. apetrides Lv 1 1 pt. 8,820
  8. Avatar for InariInari2020 108. InariInari2020 Lv 1 1 pt. 8,820
  9. Avatar for mwm64 109. mwm64 Lv 1 1 pt. 8,820
  10. Avatar for fechan 110. fechan Lv 1 1 pt. 8,820

Comments