Placeholder image of a protein
Icon representing a puzzle

2161: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
June 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,625
  2. Avatar for Go Science 2. Go Science 71 pts. 11,566
  3. Avatar for Contenders 3. Contenders 49 pts. 11,463
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,418
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,392
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,377
  7. Avatar for METU-BIN 7. METU-BIN 8 pts. 11,166
  8. Avatar for Team China 8. Team China 5 pts. 11,069
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,830
  10. Avatar for Australia 10. Australia 2 pts. 10,806

  1. Avatar for johngran 21. johngran Lv 1 37 pts. 11,266
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 35 pts. 11,259
  3. Avatar for infjamc 23. infjamc Lv 1 33 pts. 11,250
  4. Avatar for NeLikomSheet 24. NeLikomSheet Lv 1 31 pts. 11,223
  5. Avatar for Deleted player 25. Deleted player pts. 11,194
  6. Avatar for Lotus23 26. Lotus23 Lv 1 28 pts. 11,191
  7. Avatar for akaaka 27. akaaka Lv 1 26 pts. 11,172
  8. Avatar for yabuzhan 28. yabuzhan Lv 1 25 pts. 11,166
  9. Avatar for zippyc137 29. zippyc137 Lv 1 23 pts. 11,160
  10. Avatar for ichwilldiesennamen 30. ichwilldiesennamen Lv 1 22 pts. 11,155

Comments