Placeholder image of a protein
Icon representing a puzzle

2161: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since almost 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,625
  2. Avatar for Go Science 2. Go Science 71 pts. 11,566
  3. Avatar for Contenders 3. Contenders 49 pts. 11,463
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,418
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,392
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,377
  7. Avatar for METU-BIN 7. METU-BIN 8 pts. 11,166
  8. Avatar for Team China 8. Team China 5 pts. 11,069
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,830
  10. Avatar for Australia 10. Australia 2 pts. 10,806

  1. Avatar for ProfVince 41. ProfVince Lv 1 11 pts. 11,023
  2. Avatar for Oransche 42. Oransche Lv 1 10 pts. 11,020
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 9 pts. 11,000
  4. Avatar for BarrySampson 44. BarrySampson Lv 1 9 pts. 10,999
  5. Avatar for heather-1 45. heather-1 Lv 1 8 pts. 10,946
  6. Avatar for Vinara 46. Vinara Lv 1 7 pts. 10,943
  7. Avatar for Gonegirl 47. Gonegirl Lv 1 7 pts. 10,930
  8. Avatar for RockOn 48. RockOn Lv 1 6 pts. 10,846
  9. Avatar for ShadowTactics 49. ShadowTactics Lv 1 6 pts. 10,830
  10. Avatar for Alistair69 50. Alistair69 Lv 1 6 pts. 10,812

Comments