Placeholder image of a protein
Icon representing a puzzle

2161: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
June 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,625
  2. Avatar for Go Science 2. Go Science 71 pts. 11,566
  3. Avatar for Contenders 3. Contenders 49 pts. 11,463
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,418
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,392
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,377
  7. Avatar for METU-BIN 7. METU-BIN 8 pts. 11,166
  8. Avatar for Team China 8. Team China 5 pts. 11,069
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,830
  10. Avatar for Australia 10. Australia 2 pts. 10,806

  1. Avatar for Wiz kid 51. Wiz kid Lv 1 5 pts. 10,806
  2. Avatar for rezaefar 52. rezaefar Lv 1 5 pts. 10,786
  3. Avatar for RyeSnake 53. RyeSnake Lv 1 4 pts. 10,777
  4. Avatar for Trajan464 54. Trajan464 Lv 1 4 pts. 10,740
  5. Avatar for Beany 55. Beany Lv 1 4 pts. 10,735
  6. Avatar for AlkiP0Ps 56. AlkiP0Ps Lv 1 3 pts. 10,730
  7. Avatar for manu8170 57. manu8170 Lv 1 3 pts. 10,725
  8. Avatar for Hellcat6 58. Hellcat6 Lv 1 3 pts. 10,723
  9. Avatar for AlphaFold2 59. AlphaFold2 Lv 1 3 pts. 10,697
  10. Avatar for Arne Heessels 60. Arne Heessels Lv 1 3 pts. 10,692

Comments