Placeholder image of a protein
Icon representing a puzzle

2161: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
June 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,625
  2. Avatar for Go Science 2. Go Science 71 pts. 11,566
  3. Avatar for Contenders 3. Contenders 49 pts. 11,463
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,418
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,392
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,377
  7. Avatar for METU-BIN 7. METU-BIN 8 pts. 11,166
  8. Avatar for Team China 8. Team China 5 pts. 11,069
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 10,830
  10. Avatar for Australia 10. Australia 2 pts. 10,806
  1. Avatar for abiogenesis 61. abiogenesis Lv 1 2 pts. 10,641
  2. Avatar for Dr.Sillem 62. Dr.Sillem Lv 1 2 pts. 10,625
  3. Avatar for carxo 63. carxo Lv 1 2 pts. 10,625
  4. Avatar for Simek 64. Simek Lv 1 2 pts. 10,558
  5. Avatar for eskal 65. eskal Lv 1 2 pts. 10,437
  6. Avatar for antibot215 66. antibot215 Lv 1 2 pts. 10,407
  7. Avatar for heyubob 67. heyubob Lv 1 1 pt. 10,337
  8. Avatar for Larini 68. Larini Lv 1 1 pt. 10,322
  9. Avatar for Merf 69. Merf Lv 1 1 pt. 10,321
  10. Avatar for tracybutt 70. tracybutt Lv 1 1 pt. 10,310

Comments