Placeholder image of a protein
Icon representing a puzzle

2164: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since almost 4 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 23, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 9,931
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,783
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,626
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 9,069

  1. Avatar for fiendish_ghoul 31. fiendish_ghoul Lv 1 12 pts. 11,233
  2. Avatar for WBarme1234 32. WBarme1234 Lv 1 11 pts. 11,228
  3. Avatar for SemperRabbit 33. SemperRabbit Lv 1 10 pts. 11,213
  4. Avatar for zippyc137 34. zippyc137 Lv 1 9 pts. 11,205
  5. Avatar for infjamc 35. infjamc Lv 1 9 pts. 11,195
  6. Avatar for NeLikomSheet 36. NeLikomSheet Lv 1 8 pts. 11,190
  7. Avatar for Lotus23 37. Lotus23 Lv 1 7 pts. 11,186
  8. Avatar for ucad 38. ucad Lv 1 7 pts. 11,135
  9. Avatar for ProfVince 39. ProfVince Lv 1 6 pts. 11,110
  10. Avatar for Merf 40. Merf Lv 1 5 pts. 11,038

Comments