Placeholder image of a protein
Icon representing a puzzle

2164: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since almost 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 23, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,930
  2. Avatar for Go Science 2. Go Science 68 pts. 11,784
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 11,722
  4. Avatar for Contenders 4. Contenders 27 pts. 11,711
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,606
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 11,297
  7. Avatar for Australia 7. Australia 5 pts. 10,910
  8. Avatar for METU-BIN 8. METU-BIN 3 pts. 10,844
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,669
  10. Avatar for Team China 10. Team China 1 pt. 10,524

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,915
  2. Avatar for Galaxie 2. Galaxie Lv 1 95 pts. 11,865
  3. Avatar for Punzi Baker 3 3. Punzi Baker 3 Lv 1 89 pts. 11,835
  4. Avatar for gmn 4. gmn Lv 1 84 pts. 11,808
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 79 pts. 11,791
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 75 pts. 11,784
  7. Avatar for Sandrix72 7. Sandrix72 Lv 1 70 pts. 11,767
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 66 pts. 11,729
  9. Avatar for Idiotboy 9. Idiotboy Lv 1 62 pts. 11,715
  10. Avatar for MicElephant 10. MicElephant Lv 1 58 pts. 11,711

Comments