Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 8,277

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,876
  2. Avatar for Punzi Baker 3 2. Punzi Baker 3 Lv 1 95 pts. 9,765
  3. Avatar for Galaxie 3. Galaxie Lv 1 89 pts. 9,754
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 84 pts. 9,698
  5. Avatar for MicElephant 5. MicElephant Lv 1 79 pts. 9,688
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 74 pts. 9,686
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 69 pts. 9,679
  8. Avatar for gmn 8. gmn Lv 1 65 pts. 9,675
  9. Avatar for jobo0502 9. jobo0502 Lv 1 61 pts. 9,669
  10. Avatar for Sandrix72 10. Sandrix72 Lv 1 57 pts. 9,668

Comments