Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,879
  2. Avatar for Go Science 2. Go Science 60 pts. 9,698
  3. Avatar for Contenders 3. Contenders 33 pts. 9,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 9,669
  5. Avatar for Gargleblasters 5. Gargleblasters 8 pts. 9,648
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 9,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,578
  8. Avatar for Australia 8. Australia 1 pt. 9,350
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 9,346
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 9,221

  1. Avatar for Pazithi 11. Pazithi Lv 1 53 pts. 9,648
  2. Avatar for SemperRabbit 12. SemperRabbit Lv 1 50 pts. 9,644
  3. Avatar for ucad 13. ucad Lv 1 46 pts. 9,638
  4. Avatar for g_b 14. g_b Lv 1 43 pts. 9,629
  5. Avatar for maithra 15. maithra Lv 1 40 pts. 9,620
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 37 pts. 9,616
  7. Avatar for alcor29 17. alcor29 Lv 1 35 pts. 9,607
  8. Avatar for ZeroLeak7 18. ZeroLeak7 Lv 1 32 pts. 9,597
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 30 pts. 9,594
  10. Avatar for firejuggler 20. firejuggler Lv 1 28 pts. 9,594

Comments