Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,879
  2. Avatar for Go Science 2. Go Science 60 pts. 9,698
  3. Avatar for Contenders 3. Contenders 33 pts. 9,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 9,669
  5. Avatar for Gargleblasters 5. Gargleblasters 8 pts. 9,648
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 9,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,578
  8. Avatar for Australia 8. Australia 1 pt. 9,350
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 9,346
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 9,221

  1. Avatar for NeLikomSheet 21. NeLikomSheet Lv 1 26 pts. 9,584
  2. Avatar for SileNTViP 22. SileNTViP Lv 1 24 pts. 9,583
  3. Avatar for fiendish_ghoul 23. fiendish_ghoul Lv 1 22 pts. 9,580
  4. Avatar for Lotus23 24. Lotus23 Lv 1 20 pts. 9,578
  5. Avatar for silent gene 25. silent gene Lv 1 19 pts. 9,570
  6. Avatar for heather-1 26. heather-1 Lv 1 17 pts. 9,568
  7. Avatar for guineapig 27. guineapig Lv 1 16 pts. 9,564
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 14 pts. 9,554
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 13 pts. 9,532
  10. Avatar for equilibria 30. equilibria Lv 1 12 pts. 9,507

Comments