Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,879
  2. Avatar for Go Science 2. Go Science 60 pts. 9,698
  3. Avatar for Contenders 3. Contenders 33 pts. 9,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 9,669
  5. Avatar for Gargleblasters 5. Gargleblasters 8 pts. 9,648
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 9,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,578
  8. Avatar for Australia 8. Australia 1 pt. 9,350
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 9,346
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 9,221

  1. Avatar for ProfVince 31. ProfVince Lv 1 11 pts. 9,492
  2. Avatar for fpc 32. fpc Lv 1 10 pts. 9,465
  3. Avatar for zippyc137 33. zippyc137 Lv 1 9 pts. 9,439
  4. Avatar for rezaefar 34. rezaefar Lv 1 8 pts. 9,425
  5. Avatar for bamh 35. bamh Lv 1 8 pts. 9,423
  6. Avatar for infjamc 36. infjamc Lv 1 7 pts. 9,420
  7. Avatar for akaaka 37. akaaka Lv 1 6 pts. 9,415
  8. Avatar for abiogenesis 38. abiogenesis Lv 1 6 pts. 9,397
  9. Avatar for MrZanav 39. MrZanav Lv 1 5 pts. 9,384
  10. Avatar for manu8170 40. manu8170 Lv 1 5 pts. 9,366

Comments