Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,879
  2. Avatar for Go Science 2. Go Science 60 pts. 9,698
  3. Avatar for Contenders 3. Contenders 33 pts. 9,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 9,669
  5. Avatar for Gargleblasters 5. Gargleblasters 8 pts. 9,648
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 9,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,578
  8. Avatar for Australia 8. Australia 1 pt. 9,350
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 9,346
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 9,221

  1. Avatar for phi16 41. phi16 Lv 1 4 pts. 9,365
  2. Avatar for AlkiP0Ps 42. AlkiP0Ps Lv 1 4 pts. 9,350
  3. Avatar for dahast.de 43. dahast.de Lv 1 3 pts. 9,346
  4. Avatar for Beany 44. Beany Lv 1 3 pts. 9,325
  5. Avatar for jsfoldingaccount 45. jsfoldingaccount Lv 1 3 pts. 9,325
  6. Avatar for Hellcat6 46. Hellcat6 Lv 1 3 pts. 9,323
  7. Avatar for Trajan464 47. Trajan464 Lv 1 2 pts. 9,318
  8. Avatar for Idiotboy 48. Idiotboy Lv 1 2 pts. 9,310
  9. Avatar for Oransche 49. Oransche Lv 1 2 pts. 9,309
  10. Avatar for carxo 50. carxo Lv 1 2 pts. 9,291

Comments