Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,879
  2. Avatar for Go Science 2. Go Science 60 pts. 9,698
  3. Avatar for Contenders 3. Contenders 33 pts. 9,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 9,669
  5. Avatar for Gargleblasters 5. Gargleblasters 8 pts. 9,648
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 9,594
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,578
  8. Avatar for Australia 8. Australia 1 pt. 9,350
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 9,346
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 9,221

  1. Avatar for antibot215 61. antibot215 Lv 1 1 pt. 9,168
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 9,140
  3. Avatar for OperatorOrville 63. OperatorOrville Lv 1 1 pt. 9,124
  4. Avatar for kiwi081999 64. kiwi081999 Lv 1 1 pt. 9,112
  5. Avatar for bzipitidoo 65. bzipitidoo Lv 1 1 pt. 9,082
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 9,035
  7. Avatar for mengzach 67. mengzach Lv 1 1 pt. 9,012
  8. Avatar for B. A. Beder 68. B. A. Beder Lv 1 1 pt. 9,002
  9. Avatar for Lee Chun Ming 69. Lee Chun Ming Lv 1 1 pt. 8,993
  10. Avatar for Gematron 2874 70. Gematron 2874 Lv 1 1 pt. 8,990

Comments