2176: Revisiting Puzzle 143: Rosetta Decoy 7
Closed since over 3 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- July 21, 2022
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI
Top groups
-
100 pts. 9,879
-
-
-
-
-
-
-
-
-