Placeholder image of a protein
Icon representing a puzzle

2179: Electron Density Reconstruction 11

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 28, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 12,881
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 12,735
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 12,626
  4. Avatar for Team China 14. Team China 1 pt. 12,424
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,346
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 13,200
  2. Avatar for Galaxie 2. Galaxie Lv 1 95 pts. 13,182
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 90 pts. 13,175
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 85 pts. 13,172
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 80 pts. 13,170
  6. Avatar for Aubade01 6. Aubade01 Lv 1 76 pts. 13,168
  7. Avatar for Punzi Baker 3 7. Punzi Baker 3 Lv 1 72 pts. 13,164
  8. Avatar for jeff101 8. jeff101 Lv 1 68 pts. 13,160
  9. Avatar for guineapig 9. guineapig Lv 1 64 pts. 13,149
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 60 pts. 13,149

Comments

LociOiling Lv 1

Once again, we are promised a glutathione ligand, but the puzzle fails to deliver.

Electron Density Reconstruction 6, puzzle 2120, was the same deal.

Thanks to zo3xiaJonWeinberg for noticing the gap this time around.