Placeholder image of a protein
Icon representing a puzzle

2179: Electron Density Reconstruction 11

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
July 28, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 13,202
  2. Avatar for Go Science 2. Go Science 70 pts. 13,176
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 13,172
  4. Avatar for Contenders 4. Contenders 30 pts. 13,149
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 13,130
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 13,104
  7. Avatar for VeFold 7. VeFold 7 pts. 13,099
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 13,076
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 2 pts. 13,010
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 12,982
  1. Avatar for Susume 91. Susume Lv 1 1 pt. 7,346
  2. Avatar for jtscott 92. jtscott Lv 1 1 pt. 7,346

Comments

LociOiling Lv 1

Once again, we are promised a glutathione ligand, but the puzzle fails to deliver.

Electron Density Reconstruction 6, puzzle 2120, was the same deal.

Thanks to zo3xiaJonWeinberg for noticing the gap this time around.