Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,392
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 10,319
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,257
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 95 pts. 12,101
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 90 pts. 12,061
  4. Avatar for jobo0502 4. jobo0502 Lv 1 85 pts. 12,005
  5. Avatar for akaaka 5. akaaka Lv 1 80 pts. 11,968
  6. Avatar for fpc 6. fpc Lv 1 75 pts. 11,965
  7. Avatar for MicElephant 7. MicElephant Lv 1 71 pts. 11,953
  8. Avatar for g_b 8. g_b Lv 1 67 pts. 11,944
  9. Avatar for Galaxie 9. Galaxie Lv 1 63 pts. 11,934
  10. Avatar for Pazithi 10. Pazithi Lv 1 59 pts. 11,911

Comments