Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,257
  2. Avatar for Go Science 2. Go Science 63 pts. 12,116
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 12,005
  4. Avatar for Marvin's bunch 4. Marvin's bunch 21 pts. 11,965
  5. Avatar for Contenders 5. Contenders 11 pts. 11,953
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 11,911
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 11,886
  8. Avatar for Team China 8. Team China 1 pt. 11,449
  9. Avatar for Beta Folders 9. Beta Folders 1 pt. 11,112
  10. Avatar for Australia 10. Australia 1 pt. 10,956

  1. Avatar for bamh 41. bamh Lv 1 5 pts. 11,169
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 5 pts. 11,126
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 4 pts. 11,114
  4. Avatar for tracybutt 44. tracybutt Lv 1 4 pts. 11,112
  5. Avatar for Deleted player 45. Deleted player 4 pts. 11,061
  6. Avatar for PeterDav 46. PeterDav Lv 1 3 pts. 11,027
  7. Avatar for kyoota 47. kyoota Lv 1 3 pts. 10,995
  8. Avatar for Zosa 48. Zosa Lv 1 3 pts. 10,978
  9. Avatar for AlkiP0Ps 49. AlkiP0Ps Lv 1 2 pts. 10,956
  10. Avatar for Visok 50. Visok Lv 1 2 pts. 10,920

Comments