2182: Revisiting Puzzle 144: Rosetta Decoy 8
Closed since over 3 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- August 04, 2022
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP
Top groups
-
100 pts. 12,257
-
-
-
-
-
-
-
-
-