Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,257
  2. Avatar for Go Science 2. Go Science 63 pts. 12,116
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 12,005
  4. Avatar for Marvin's bunch 4. Marvin's bunch 21 pts. 11,965
  5. Avatar for Contenders 5. Contenders 11 pts. 11,953
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 11,911
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 11,886
  8. Avatar for Team China 8. Team China 1 pt. 11,449
  9. Avatar for Beta Folders 9. Beta Folders 1 pt. 11,112
  10. Avatar for Australia 10. Australia 1 pt. 10,956

  1. Avatar for Arne Heessels 61. Arne Heessels Lv 1 1 pt. 10,607
  2. Avatar for pfirth 62. pfirth Lv 1 1 pt. 10,513
  3. Avatar for Larini 63. Larini Lv 1 1 pt. 10,486
  4. Avatar for Oransche 64. Oransche Lv 1 1 pt. 10,432
  5. Avatar for DScott 65. DScott Lv 1 1 pt. 10,411
  6. Avatar for dahast.de 66. dahast.de Lv 1 1 pt. 10,392
  7. Avatar for Baconfry 67. Baconfry Lv 1 1 pt. 10,380
  8. Avatar for Mohoernchen 68. Mohoernchen Lv 1 1 pt. 10,366
  9. Avatar for hada 69. hada Lv 1 1 pt. 10,362
  10. Avatar for Amynet 70. Amynet Lv 1 1 pt. 10,361

Comments