Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,257
  2. Avatar for Go Science 2. Go Science 63 pts. 12,116
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 12,005
  4. Avatar for Marvin's bunch 4. Marvin's bunch 21 pts. 11,965
  5. Avatar for Contenders 5. Contenders 11 pts. 11,953
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 11,911
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 11,886
  8. Avatar for Team China 8. Team China 1 pt. 11,449
  9. Avatar for Beta Folders 9. Beta Folders 1 pt. 11,112
  10. Avatar for Australia 10. Australia 1 pt. 10,956
  1. Avatar for zippyc137 21. zippyc137 Lv 1 28 pts. 11,741
  2. Avatar for BootsMcGraw 22. BootsMcGraw Lv 1 26 pts. 11,741
  3. Avatar for phi16 23. phi16 Lv 1 24 pts. 11,729
  4. Avatar for sallallami 24. sallallami Lv 1 22 pts. 11,715
  5. Avatar for Bruno Kestemont 25. Bruno Kestemont Lv 1 21 pts. 11,711
  6. Avatar for infjamc 26. infjamc Lv 1 19 pts. 11,705
  7. Avatar for SemperRabbit 27. SemperRabbit Lv 1 18 pts. 11,680
  8. Avatar for fiendish_ghoul 28. fiendish_ghoul Lv 1 17 pts. 11,654
  9. Avatar for Calimero Sombrero 29. Calimero Sombrero Lv 1 15 pts. 11,633
  10. Avatar for alcor29 30. alcor29 Lv 1 14 pts. 11,572

Comments