Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,257
  2. Avatar for Go Science 2. Go Science 63 pts. 12,116
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 12,005
  4. Avatar for Marvin's bunch 4. Marvin's bunch 21 pts. 11,965
  5. Avatar for Contenders 5. Contenders 11 pts. 11,953
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 11,911
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 11,886
  8. Avatar for Team China 8. Team China 1 pt. 11,449
  9. Avatar for Beta Folders 9. Beta Folders 1 pt. 11,112
  10. Avatar for Australia 10. Australia 1 pt. 10,956

  1. Avatar for Dr.Sillem 71. Dr.Sillem Lv 1 1 pt. 10,350
  2. Avatar for pruneau_44 72. pruneau_44 Lv 1 1 pt. 10,339
  3. Avatar for B. A. Beder 73. B. A. Beder Lv 1 1 pt. 10,325
  4. Avatar for bkoep 74. bkoep Lv 1 1 pt. 10,319
  5. Avatar for zbp 75. zbp Lv 1 1 pt. 10,307
  6. Avatar for mart0258 76. mart0258 Lv 1 1 pt. 10,301
  7. Avatar for rinze 77. rinze Lv 1 1 pt. 10,268
  8. Avatar for abiogenesis 78. abiogenesis Lv 1 1 pt. 10,249
  9. Avatar for illex 79. illex Lv 1 1 pt. 10,210
  10. Avatar for evifnoskcaj 80. evifnoskcaj Lv 1 1 pt. 10,191

Comments