Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,452
  2. Avatar for grogar7 2. grogar7 Lv 1 95 pts. 12,170
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 89 pts. 12,115
  4. Avatar for MicElephant 4. MicElephant Lv 1 84 pts. 12,033
  5. Avatar for WBarme1234 5. WBarme1234 Lv 1 79 pts. 12,021
  6. Avatar for BackBuffer 6. BackBuffer Lv 1 75 pts. 12,008
  7. Avatar for Punzi Baker 3 7. Punzi Baker 3 Lv 1 70 pts. 12,003
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 66 pts. 11,980
  9. Avatar for ucad 9. ucad Lv 1 62 pts. 11,974
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 58 pts. 11,960

Comments