Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 12,447
  2. Avatar for LociOiling 2. LociOiling Lv 1 65 pts. 12,438
  3. Avatar for gmn 3. gmn Lv 1 41 pts. 12,433
  4. Avatar for alcor29 4. alcor29 Lv 1 24 pts. 12,411
  5. Avatar for phi16 5. phi16 Lv 1 14 pts. 12,410
  6. Avatar for SemperRabbit 6. SemperRabbit Lv 1 7 pts. 12,406
  7. Avatar for fpc 7. fpc Lv 1 4 pts. 12,042
  8. Avatar for Lotus23 8. Lotus23 Lv 1 2 pts. 12,034
  9. Avatar for MicElephant 9. MicElephant Lv 1 1 pt. 12,029
  10. Avatar for maithra 10. maithra Lv 1 1 pt. 12,025

Comments