Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,452
  2. Avatar for Go Science 2. Go Science 68 pts. 12,115
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 12,042
  4. Avatar for Contenders 4. Contenders 27 pts. 12,033
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 11,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 11,912
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 11,624
  8. Avatar for Team China 8. Team China 3 pts. 11,609
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 11,605
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 11,480

  1. Avatar for alcor29 21. alcor29 Lv 1 27 pts. 11,799
  2. Avatar for ichwilldiesennamen 22. ichwilldiesennamen Lv 1 25 pts. 11,792
  3. Avatar for akaaka 23. akaaka Lv 1 23 pts. 11,790
  4. Avatar for g_b 24. g_b Lv 1 22 pts. 11,734
  5. Avatar for SemperRabbit 25. SemperRabbit Lv 1 20 pts. 11,732
  6. Avatar for dcrwheeler 26. dcrwheeler Lv 1 18 pts. 11,718
  7. Avatar for Lotus23 27. Lotus23 Lv 1 17 pts. 11,711
  8. Avatar for equilibria 28. equilibria Lv 1 16 pts. 11,679
  9. Avatar for maithra 29. maithra Lv 1 14 pts. 11,670
  10. Avatar for PeterDav 30. PeterDav Lv 1 13 pts. 11,649

Comments