Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,452
  2. Avatar for Go Science 2. Go Science 68 pts. 12,115
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 12,042
  4. Avatar for Contenders 4. Contenders 27 pts. 12,033
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 11,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 11,912
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 11,624
  8. Avatar for Team China 8. Team China 3 pts. 11,609
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 11,605
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 11,480

  1. Avatar for Wilko2 81. Wilko2 Lv 1 1 pt. 10,683
  2. Avatar for platinum9091 82. platinum9091 Lv 1 1 pt. 10,523
  3. Avatar for RockOn 83. RockOn Lv 1 1 pt. 10,204
  4. Avatar for nene liu 84. nene liu Lv 1 1 pt. 10,133
  5. Avatar for Pesky159 85. Pesky159 Lv 1 1 pt. 9,683
  6. Avatar for joshmiller 86. joshmiller Lv 1 1 pt. 8,949
  7. Avatar for bkoep 87. bkoep Lv 1 1 pt. 8,949

Comments