2194: Revisiting Puzzle 148: Rosetta Decoy 11
Closed since over 3 years ago
Novice Overall PredictionSummary
- Created
- September 01, 2022
- Expires
- Max points
- 100
Note: This puzzle closes a day early, on September 7, due to a scheduled Foldit update.
This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.
Sequence:
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL
Top groups
-
1. LociOiling Lv 1100 pts. 11,427 -
-
-
-
-
-
-
-
-
Comments
LociOiling Lv 1
This puzzle would normally expire on Thursday in most US time zones. Instead, it expires on Wednesday, the same day as puzzle 2193.
The website also shows both 2193 and 2194 expiring at 16:00 UTC, which is not one of the normal times. Wednesday and Friday puzzles normally expire at 23:00 UTC, while Thursday puzzles expire at 18:00 UTC.
Another wrinkle is what's shown in the client when you hover over the puzzle title. Puzzle 2193 shows the normal date and time. The time is different than what's shown on the website.
Puzzle 2194 shows the same date and time on both the website and in the client. I guess there's something to be said for consistency.
LociOiling Lv 1
See new Foldit website for the reasons behind the early expiration.