Placeholder image of a protein
Icon representing a puzzle

2194: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 01, 2022
Expires
Max points
100
Description

Note: This puzzle closes a day early, on September 7, due to a scheduled Foldit update.



This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,456
  2. Avatar for Go Science 2. Go Science 60 pts. 11,175
  3. Avatar for Contenders 3. Contenders 33 pts. 11,140
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 10,969
  5. Avatar for Marvin's bunch 5. Marvin's bunch 8 pts. 10,967
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 10,914
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,693
  8. Avatar for Australia 8. Australia 1 pt. 10,348
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 9,976
  10. Avatar for CH4110 Fold it! 10. CH4110 Fold it! 1 pt. 9,257
  1. Avatar for manu8170 41. manu8170 Lv 1 6 pts. 10,612
  2. Avatar for Crossed Sticks 42. Crossed Sticks Lv 1 6 pts. 10,569
  3. Avatar for Alistair69 43. Alistair69 Lv 1 5 pts. 10,544
  4. Avatar for stomjoh 44. stomjoh Lv 1 5 pts. 10,502
  5. Avatar for rezaefar 45. rezaefar Lv 1 4 pts. 10,466
  6. Avatar for ProfVince 46. ProfVince Lv 1 4 pts. 10,440
  7. Avatar for Vinara 47. Vinara Lv 1 4 pts. 10,424
  8. Avatar for Pazithi 48. Pazithi Lv 1 3 pts. 10,415
  9. Avatar for Beany 49. Beany Lv 1 3 pts. 10,403
  10. Avatar for AlkiP0Ps 50. AlkiP0Ps Lv 1 3 pts. 10,348

Comments

LociOiling Lv 1

This puzzle would normally expire on Thursday in most US time zones. Instead, it expires on Wednesday, the same day as puzzle 2193.

The website also shows both 2193 and 2194 expiring at 16:00 UTC, which is not one of the normal times. Wednesday and Friday puzzles normally expire at 23:00 UTC, while Thursday puzzles expire at 18:00 UTC.

Another wrinkle is what's shown in the client when you hover over the puzzle title. Puzzle 2193 shows the normal date and time. The time is different than what's shown on the website.

Puzzle 2194 shows the same date and time on both the website and in the client. I guess there's something to be said for consistency.