Icon representing a puzzle

2197: Electron Density Reconstruction 12: Round 2

Closed since over 3 years ago

Novice Overall Electron Density

Summary

Created
September 08, 2022
Expires
Max points
100
Description

Since the previous Puzzle 2191 we've adjusted the starting structure to include a residue that is absent in the deposited structure. Players may not load solutions from the Puzzle 2191. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 13,645
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,173
  3. Avatar for RubiscoBobGroup 13. RubiscoBobGroup 1 pt. 13,072
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 12,693
  5. Avatar for Window Group 15. Window Group 1 pt. 8,487
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 0
  1. Avatar for Vinara 21. Vinara Lv 1 27 pts. 18,578
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 25 pts. 18,567
  3. Avatar for Idiotboy 23. Idiotboy Lv 1 23 pts. 18,566
  4. Avatar for dettingen 24. dettingen Lv 1 21 pts. 18,561
  5. Avatar for equilibria 25. equilibria Lv 1 20 pts. 18,559
  6. Avatar for jausmh 26. jausmh Lv 1 18 pts. 18,535
  7. Avatar for akaaka 27. akaaka Lv 1 17 pts. 18,508
  8. Avatar for blazegeek 28. blazegeek Lv 1 15 pts. 18,473
  9. Avatar for Bruno Kestemont 29. Bruno Kestemont Lv 1 14 pts. 18,419
  10. Avatar for Calimero Sombrero 30. Calimero Sombrero Lv 1 13 pts. 18,417

Comments

Sandrix72 Lv 1

I observed several sudden crashes of the new program. I use Win10. There are no error messages, and I cannot say yet if this is a bug related especially to this puzzle or not.
Recipe that was running before the crash: LR9