Icon representing a puzzle

2197: Electron Density Reconstruction 12: Round 2

Closed since over 3 years ago

Novice Overall Electron Density

Summary

Created
September 08, 2022
Expires
Max points
100
Description

Since the previous Puzzle 2191 we've adjusted the starting structure to include a residue that is absent in the deposited structure. Players may not load solutions from the Puzzle 2191. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 13,645
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,173
  3. Avatar for RubiscoBobGroup 13. RubiscoBobGroup 1 pt. 13,072
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 12,693
  5. Avatar for Window Group 15. Window Group 1 pt. 8,487
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 0
  1. Avatar for PieThrower 31. PieThrower Lv 1 12 pts. 18,401
  2. Avatar for maithra 32. maithra Lv 1 11 pts. 18,392
  3. Avatar for SemperRabbit 33. SemperRabbit Lv 1 10 pts. 18,289
  4. Avatar for Crossed Sticks 34. Crossed Sticks Lv 1 9 pts. 18,158
  5. Avatar for MrZanav 35. MrZanav Lv 1 8 pts. 18,147
  6. Avatar for Alistair69 36. Alistair69 Lv 1 8 pts. 18,113
  7. Avatar for a5hm0r 37. a5hm0r Lv 1 7 pts. 18,090
  8. Avatar for robgee 38. robgee Lv 1 6 pts. 18,076
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 6 pts. 18,074
  10. Avatar for Merf 40. Merf Lv 1 5 pts. 17,966

Comments

Sandrix72 Lv 1

I observed several sudden crashes of the new program. I use Win10. There are no error messages, and I cannot say yet if this is a bug related especially to this puzzle or not.
Recipe that was running before the crash: LR9